NPPB antibody (AA 1-32)

Catalog No. ABIN6757749

This anti-NPPB antibody is a Mouse Monoclonal antibody detecting NPPB in ELISA. Suitable for Human.

Quick Overview for NPPB antibody (AA 1-32) (ABIN6757749)

Target: NPPB (Natriuretic Peptide Precursor B (NPPB))

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This NPPB antibody is un-conjugated

Application: ELISA

Clone: 21-Mar

Product Details anti-NPPB Antibody

Binding Specificity: AA 1-32

Specificity: Recognizes synthetic human Brain Natriuretic Peptide (aa 1-32).

Predicted Reactivity: Percent identity by BLAST analysis: Human, Gibbon (100%).

Purification: Protein G purified

Immunogen: Synthetic human BNP (aa 1-32) KLH conjugated (SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH). Percent identity by BLAST analysis: Human, Gibbon (100%).

Isotype: IgG2b

Application Details

Application Notes: Approved: ELISA

Usage: Suitable for use in ELISA.

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from PBS,  pH 7.2

Storage: 4 °C,-20 °C

Storage Comment: Lyophilized powder may be stored at 4°C for short-term only. Reconstituted product is stable for 1 year at -20°C.

Target Details for NPPB

Target: NPPB (Natriuretic Peptide Precursor B (NPPB))

Alternative Name: NPPB / BNP

Background: Name/Gene ID: NPPB

Synonyms: NPPB, BNP, Natriuretic peptides B, Natriuretic peptide B, Natriuretic protein, Brain type natriuretic peptide

Gene ID: 4879

UniProt: P16860

Pathways: Hormone Activity